Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
Application Applicant 2/29/2024
Revised 1/7/14 KL 1 of 11 City of Springfield Development & Public Works 225 Fifth Street Springfield, OR 97477 Site Plan Review Application Type (Applicant: check one) Site Plan Review Pre-Submittal: Major Site Plan Modification Pre-Submittal: Site Plan Review Submittal: Major Site Plan Modification Submittal: Required Project Information (Applicant: complete this section) Applicant Name: Phone: Company: Email: Address: Applicant’s Rep.: Phone: Company: Email: Address: Property Owner: Phone: Company: Email: Address: ASSESSOR'S MAP NO: TAX LOT NO(S): Property Address: Size of Property: Acres Square Feet Proposed No. of Dwelling Units per acre: Proposed Name of Project: Description of Proposal: If you are filling in this form by hand, please attach your proposal description to this application. Existing Use: New Impervious Surface Coverage (Including Bldg. Gross Floor Area): sf Signatures: Please sign and print your name and date in the appropriate box on the next page. Required Project Information (City Intake Staff: complete this section) Associated Applications: Signs: Pre-Sub Case No.: Date: Reviewed by: Case No.: Date: Reviewed by: Application Fee: $ Technical Fee: $ Postage Fee: $ TOTAL FEES: $ PROJECT NUMBER: Revised 1/7/14 KL 3 of 11 Site Plan Review Application Process 1. Applicant Submits a Site Plan Review Application for Pre-Submittal The application must conform to the Site Plan Review Submittal Requirements Checklist on pages 4-7 of this application packet. A pre-submittal meeting to discuss completeness is mandatory, and pre-submittal meetings are conducted every Tuesday and Friday, from 10:00 am - noon. Planning Division staff strives to conduct pre-submittal meetings within five to seven working days of receiving an application. 2. Applicant and the City Conduct the Pre-Submittal Meeting The applicant, owner, and design team are strongly encouraged to attend the pre- submittal meeting. The meeting is held with representatives from Public Works Engineering and Transportation, Community Services (Building), Fire Marshall’s office, and the Planning Division and is scheduled for 30 to 60 minutes. The Planner provides the applicant with a Pre-Submittal Checklist specifying the items required to make the application complete if it is not already complete, and the applicant has 180 days submit a complete application to the City. 3. Applicant Submits a Complete Application, City Staff Review the Application and Issue a Decision A complete application must conform to the Site Plan Review Submittal Requirements Checklist on pages 4-7 of this application packet. A Type II decision, made after public notice, but without a public hearing, unless appealed, is issued within 120 days of submittal of a complete application. Mailed notice is provided to property owners and occupants within 300 feet of the property being reviewed and to any applicable neighborhood association. In addition, the applicant must post one sign, provided by the City, on the subject property. There is a 14-day public comment period, starting on the date notice is mailed. Applications are distributed to the Development Review Committee, and their comments are incorporated into a decision that addresses all applicable approval criteria and/or development standards, as well as any written comments from those given notice. Applications may be approved, approved with conditions, or denied. At the applicant’s request, the Planner can provide a copy of the draft land use decision prior to issuing the final land use decision. The City mails the applicant and any party of standing a copy of the decision, which is effective on the day it is mailed. The decision issued is the final decision of the City but may be appealed within 15 calendar days to the Planning Commission or Hearings Official. Revised 1/7/14 KL 4 of 11 Site Plan Review Submittal Requirements Checklist NOTE: ALL of the following items MUST be submitted for BOTH Pre-Submittal and Submittal. If you feel an item on the list below does not apply to your specific application, please state the reason why and attach the explanation to this form. Application Fee – refer to the Development Code Fee Schedule for the appropriate fee calculation formula. A copy of the fee schedule is available at the Development & Public Works Department. Any applicable application, technology, and postage fees are collected at the pre-submittal and submittal stages. Site Plan Review Application Form Narrative explaining the purpose of the proposed development, the existing use of the property, and any additional information that may have a bearing in determining the action to be taken. The narrative should also include the proposed number of employees and future expansion plans, if known. Density – if applicable, list the size of property (acres), maximum allowable density and the density proposed. Copy of the Deed Copy of the Site Plan Reduced to 8½”x 11”, which will be mailed as part of the required neighboring property notification packet. State or Federal Permits Required – The applicant must demonstrate that an application has been submitted for any required federal or state permit and provide a copy of the application upon request. Completed Attached Scoping Sheet Four (4) Copies of the Following Plan Sets for Pre-Submittal OR Four (4) Copies of the Following Plan Sets for Submittal: All of the following plans must include the scale appropriate to the area involved and sufficient to show detail of the plan and related data, north arrow, and date of preparation. All plan sets must be folded to 8½” by 11” and bound by rubber bands. Please Note: These plans must provide enough information to enable the City to determine that the proposed development is feasible, but are not necessarily required to be detailed construction level documents. The City’s Engineering Design Standards Manual, while not land use criteria, may be used in whole or n part, by the City Engineer to determine the feasibility of a proposed plan. Nothing herein should be interpreted as implying any requirement in contradiction of Oregon Statute or Oregon Administrative Regulation. Revised 1/7/14 KL 5 of 11 a. Site Assessment of Existing Conditions Prepared by an Oregon licensed Architect, Landscape Architect, Civil Engineer or Surveyor Vicinity Map The name, location and dimensions of all existing site features including buildings, curb cuts, trees and impervious surface areas, clearly indicating what is remaining and what is being removed. For existing structures to remain, also indicate present use, size, setbacks from property lines, and distance between buildings. The name, location, dimensions, direction of flow and top of bank of all watercourses and required riparian setback that are shown on the Water Quality Limited Watercourse Map on file in the Development & Public Works Department The 100-year floodplain and floodway boundaries on the site, as specified in the latest adopted FEMA Flood Insurance Rate Maps or FEMA approved Letter of Map Amendment or Letter of Map Revision The Time of Travel Zones, as specified in SDC 3.3-200 and delineated on the Wellhead Protection Areas Map on file in the Development & Public Works Department Physical features including, but not limited to trees 5” in diameter or greater when measured 4 ½ feet above the ground (stands of more than five (5) trees may be shown as a cluster with mix of trees species noted), riparian areas, wetlands and rock outcroppings b. Site Plan Prepared by an Oregon licensed Architect, Landscape Architect, Civil Engineer or Surveyor Proposed buildings: location, dimensions, size (gross floor area applicable to the parking requirement for the proposed use(s)), setbacks from property lines, and distance between buildings; measured setbacks shall be prepared by an Oregon licensed Surveyor when minimum setbacks are shown. Location and height of existing or proposed fences, walls, outdoor equipment, storage, trash receptacles, and signs Location, dimensions, and number of typical, compact and ADA parking spaces; including aisles, wheel bumpers, directional signs, and striping. ADA routes from public rights-of-way whall be designated including at grade connections Dimensions of the development area, as well as area and percentage of the site proposed for buildings, structures, parking and vehicular areas, sidewalks, patios, and other impervious surfaces Observance of solar access requirements as specified in the applicable zoning district On-site loading areas and vehicular and pedestrian circulation Access to streets, alleys, and properties to be served, including the location and dimensions of existing and proposed curb cuts and curb cuts proposed to be closed Location, type, and number of bicycle parking spaces Note location of existing and planned Lane Transit District facilities (within ½ mile) Revised 1/7/14 KL 6 of 11 Area and dimensions of all property to be conveyed, dedicated, or reserved for common open spaces, recreational areas, and other similar public and semi-public uses Phased Development Plan – where applicable, the Site Plan application must include a phasing plan indicating any proposed phases for development, including the boundaries and sequencing of each phase. Phasing must progress in a defined sequence addressing street connectivity between the various phases and accommodating the logical extension of other required public improvements, including but to limited to, sanitary sewer, stormwater management, water and electricity. The applicant must clearly indicate which phases are proposed for approval under the current Site Plan application and which are deferred to future review procedures. c. Existing Improvement and Public Utilities Plan Prepared by an Oregon licensed Architect, Landscape Architect, Civil Engineer or Surveyor Location and width of all existing easements Location, widths (of paving and right-of-way), and names of all existing streets, alleys, dedications or other right-of-ways within or adjacent to the proposed development, including jurisdictional status other than City. Indicate connection points for roof drainage. Location and type of existing street lighting Location of existing and required traffic control devices, fire hydrants, power poles, transformers, neighborhood mailbox units, waterline backflow preventers and similar public facilities Location, width, and construction material of all existing and proposed sidewalks, sidewalk ramps, pedestrian access ways, and trails Location and size of existing utilities on and adjacent to the site including sanitary sewer mains, stormwater management systems, water mains, power, gas, telephone, and cable TV. Indicate the proposed connection points. Detail must be proportionate to the complexity of the proposed project. Show existing and proposed spot elevations or contours, and direction of drainage patterns. d. Proposed Grading, Paving, & Utilities Plan Prepared by an Oregon licensed Civil Engineer, except where noted below The approximate size and location of storm water management systems components Location, widths (of paving and right-of-way), and names of proposed streets, alleys, dedications or other rights-of-ways within or adjacent to the proposed development Location and width of all proposed easements Location and type of proposed street lighting Information on existing slopes over 5% shall be prepared by an Oregon licensed surveyor and be drawn with one foot contour interval lines; land with a slope over 10 percent shall be shown with 5 foot contour interval lines Revised 1/7/14 KL 7 of 11 e. Landscape Plan Prepared by an Architect, Landscape Architect, or other Landscape Professional approved by the Director Location and dimensions of landscaping and open space areas to include calculation of landscape coverage Where applicable, screening in accordance with SDC 4.4-110 Location of existing and proposed street trees f. Architectural Plans Where abutting residentially zoned properties, exterior elevations of all proposed structures over 140 square feet for the development site, including height, shall be shown g. On-Site Lighting Plan Location, orientation, and maximum height of exterior light fixtures, both free standing and attached Type and extent of shielding, including cut-off angles, and type of illumination, wattage, and luminous area Additional Materials That May be Deferred at the discretion of the applicant until Final Site Plan or Building Permit Submittal: List in chart form the proposed types of landscape materials (trees, shrubs, ground cover). Include in the chart genus, species, common name, quantity, size and spacing Where plants are proposed as part of the stormwater management system, a planting plan shall be provided. Irrigation Plan showing of irrigation lines, required backflow preventers and above ground utilities. Photometric test report for each light source. An applicant may submit conceptual floor plans in order to have staff address Resolution of potential nuisance conflicts Additional Materials That May be Required by the Director: IT IS THE APPLICANT’S RESPONSIBILITY TO DETERMINE IF ADDITIONAL STANDARDS/APPLICATIONS APPLY TO THE PROPOSED DEVELOPMENT. THE APPLICANT SHOULD CONSIDER UTILIZING PRE-DEVELOPMENT MEETINGS AS DISCUSSED IN SDC 5.1-120: Copy of a Preliminary Title Report issued within the past 30 days documenting ownership and listing all encumbrances. A developer may be required to prepare a Traffic Impact Study (TIS) to identify potential traffic impacts from proposed development and needed mitigation measures. Revised 1/7/14 KL 8 of 11 Where a multi-family development is proposed, any additional materials to demonstrate compliance with SDC 3.2-240 Riparian Area Protection Report for properties located within 150 feet of the top of bank of any Water Quality Limited Watercourses (WQLW) or within 100 feet of the top of bank of any direct tributaries of WQLW A Geotechnical Report prepared by an engineer must be submitted concurrently if the Soils Survey indicates the proposed development area has unstable soils and/or a high water table, or if required by the City Engineer Where the development area is within an overlay district, address the additional standards of the overlay district on plans and narratives Where physical aspects of a proposed development, including but not limited to scale, odor noise, glare or vibration, will impact less intensive surrounding uses, the Director may request submittal of conceptual floor plans or other information necessary to determine compliance with applicable standards. If five or more trees are proposed to be removed, a Tree Felling Permit as specified in SDC 5.19-100 A wetland delineation approved by the Oregon Division of State Lands must be submitted concurrently where there is a wetland on the property The applicant must demonstrate that an application has been submitted for any required federal or state permit and provide a copy of the application upon request Where any grading, filling or excavating is proposed with the development, a Land and Drainage Alteration permit must be submitted prior to development Where applicable, any Discretionary Use or Variance as specified in SDC 5.9-100 and 5.21-100 An Annexation shall be submitted prior to submission of application, as specified In SDC 5.7-100, where a development is proposed outside of the city limits but within the City’s urban service area and can be served by sanitary sewer December 6, 2013 REQUIRED STORMWATER SCOPING SHEET USE POLICY: In October 2003, Springfield Public Works released a trial “stormwater scoping sheet,” provided to help engineers and developers meet stormwater requirements in the Springfield Development Code (SDC) and Engineering Design Standards and Procedures Manual (EDSPM). After a five month trial period, it became apparent that users of the scoping sheet submitted much more complete applications than non-users. An added bonus was a decrease in the overall review time spent on the applications, resulting in quicker notice of decisions. As a result of the benefits of the scoping sheets, the City has decided to make their use a mandatory process. Current city policy is that the use of stormwater scoping sheets is required for all applications which require development review. All applications submitted to the City shall provide a copy of a completed stormwater scoping sheet with the application packet. Attached with this letter is the latest version of the scoping sheet, which reflects changes requested by the development community. PLEASE NOTE: SUBMITTED APPLICATIONS WILL NOW BE REQUIRED TO SUBMIT A COMPLETED STORMWATER SCOPING SHEET, STORMWATER STUDY AND PLANS IN CONFORMANCE WITH THE SCOPE REQUIREMENTS DIRECTIONS FOR USING STORMWATER SCOPING SHEETS ARE AS FOLLOWS: 1.) Obtain scoping sheet from application packet, city website, or other location. 2.) Fill out project information (top half of front sheet) prior to commencement of work on stormwater study. (Note: Do not sign scoping sheet until it is received from the City with requirements checked.) 3.) Mail, fax, or email all pages to: City of Springfield, Development and Public Works Dept., Attn: Clayton McEachern. 4.) Receive completed scoping sheet (filled out by the City) indicating minimum requirements for a complete stormwater study. 5.) Include four (4) copies of complete scoping sheet (signed by engineer at the bottom of page 2), stormwater study and plans that comply with the minimum required scope with submittal of application packet. The scoping sheet shall be included as an attachment, inside the front cover of the stormwater study. Stormwater scoping sheets can be found with all application packets (City website and the DPW front counter) as well as on the Engineering and Construction Resources webpage located at: http://www.springfield- or.gov/DPW/EngineeringandConstructionResources.htm under the Public Improvement Permit Projects Forms section. Thank you in advance for working with the City of Springfield with this new process. Sincerely, Clayton McEachern, PE City of Springfield, Development and Public Works Email: cmceachern@springfield-or.gov Phone: (541) 736 – 1036 Fax: (541) 736 – 1021 CITY OF SPRINGFIELD, OREGON DEVELOPMENT AND PUBLIC WORKS 225 FIFTH STREET SPRINGFIELD, OR 97477 PHONE: 541.726.3753 FAX: 541.736.1021 www.springfield-or.gov Return to Clayton McEachern @ City of Springfield, email: cmceachern@springfield-or,gov, FAX: (541) 736-1021 CITY OF SPRINGFIELD, OREGON DEVELOPMENT AND PUBLIC WORKS 225 FIFTH STREET SPRINGFIELD, OR 97477 PHONE: 541.726.3753 FAX: 541.726.1021 www.springfield-or.gov STORMWATER MANAGEMENT SYSTEM SCOPE OF WORK Project Name: Rosboro Springfield Plant Improvements Applicant: Matt Keenan, KPFF Assessors Parcel #: Map: 17033600 Lots: 100, 300, 401 Date: 02/26/2024 Land Use(s): Industrial Plant Improvements Phone #: 541-735-9251 Project Size (Acres): 12.24 acres 55 Fax #: Approx. Impervious Area: 12.24 acres Email: Matt.keenan@kpff.com Project Description (Include a copy of Assessor’s map): Project will include the revision of campus operations through the removal of an existing building and misc. structures, and introducing two new buildings, additional site access and parking. Drainage Proposal (Public connection(s), discharge location(s), etc. Attach additional sheet(s) if necessary: Storm runoff will be collected on-site via roof drains, downspouts, area drains and trapped catch basins. All runoff will be re- routed through a sedimentation manhole and hydrodynamic separator, prior to connecting to the existing storm connection on-site at city manhole #50571 Proposed Stormwater Best Management Practices: Concrete truck washout, construction entrance, inlet protection, silt fencing. Additionally all catch basins within vehicle pavements will be trapped for oil/grease separation. Drainage Study Type (EDSPM Section 4.03.2): (Note, UH may be substituted for Rational Method) Small Site Study – (use Rational Method for calculations) Mid-Level Development Study – (use Unit Hydrograph Method for calculations) Full Drainage Development Study – (use Unit Hydrograph Method for calculations) Environmental Considerations: Wellhead Zone: Hillside Development: Wetland/Riparian: Floodway/Floodplain: Soil Type: Other Jurisdictions Downstream Analysis: N/A Flow line for starting water surface elevation: Design HGL to use for starting water surface elevation: Manhole/Junction to take analysis to: --------------------------------- (Area below this line filled out by the City and Returned to the Applicant) ---------------------------- (At a minimum, all boxes checked by the City on the front and back of this sheet shall be submitted for an application to be complete for submittal, although other requirements may be necessary.) ------------------------------------------------- (Area below this line filled out by Applicant) -------------------------------------------------- (Please return to Clayton McEachern @ City of Springfield Development and Public Works; Fax # 736-1021, Phone # 736-1036), email:cmceachern@springfield-or.gov Form Version 5: June 2015 COMPLETE STUDY ITEMS * Based upon the information provided on the front of this sheet, the following represents a minimum of what is needed for an application to be complete for submittal with respect to drainage; however, this list should not be used in lieu of the Springfield Development Code (SDC) or the City’s Engineering Design Manual. Compliance with these requirements does not constitute site approval; Additional site specific information may be required. Note: Upon scoping sheet submittal, ensure completed form has been signed in the space provided below: Interim Design Standards/Water Quality (EDSPM Chapter 3) Req’d N/A All non-building rooftop (NBR) impervious surfaces shall be pre-treated (e.g. multi-chambered catchbasin w/oil filtration media) for stormwater quality. Additionally, a minimum of 50% of the NBR impervious surface shall be treated by vegetated methods. Where required, vegetative stormwater design shall be consistent with design standards (EDSPM Section 3.02), set forth in Chapter 2 of the Eugene Stormwater Management Manual. For new NBR impervious area less than 15,000 square feet, a simplified design approach may be followed as specified by the Eugene Stormwater Management Manual (Sec2.4.1). If a stormwater treatment swale is proposed, submit calculations/specifications for sizing, velocity, flow, side slopes, bottom slope, and seed mix consistent with City of Springfield or Eugene’s Stormwater Management Manual. Water Quality calculations as required in Section 3.03.1 of the EDSPM. All building rooftop mounted equipment, or other fluid containing equipment located outside of the building, shall be provided with secondary containment or weather resistant enclosure. General Study Requirements (EDSPM Section 4.03) Drainage study prepared by a Professional Civil Engineer licensed in the state of Oregon. A complete drainage study, as required in EDSPM Section 4.03.1, including a hydrological study map. Calculations showing system capacity for a 2-year storm event and overflow effects of a 25-year storm event. The time of concentration (Tc) shall be determined using a 10 minute start time for developed basins. Review of Downstream System (EDSPM Section 4.03.4.C) A downstream drainage analysis as described in EDSPM Section 4.03.4.C. On-site drainage shall be governed by the Oregon Plumbing Specialty Code (OPSC). Elevations of the HGL and flow lines for both city and private systems where applicable. Design of Storm Systems (EDSPM Section 4.04). Flow lines, slopes, rim elevations, pipe type and sizes clearly indicated on the plan set. Minimum pipe cover shall be 18 inches for reinforced pipe and 36 inches for plain concrete and plastic pipe materials, or proper engineering calculations shall be provided when less. The cover shall be sufficient to support an 80,000 lb load without failure of the pipe structure. Manning’s “n” values for pipes shall be consistent with Table 4-1 of the EDSP. All storm pipes shall be designed to achieve a minimum velocity of three (3) feet per second at 0.5 pipe full based on Table 4-1 as well. Other/Miscellaneous Existing and proposed contours, located at one foot interval. Include spot elevations and site grades showing how site drains. Private stormwater easements shall be clearly depicted on plans when private stormwater flows from one property to another. Drywells shall not receive runoff from any surface w/o being treated by one or more BMPs, with the exception of residential building roofs (EDSP Section 3.03.4.A). Additional provisions apply to this as required by the DEQ. Refer to the website: http://www.deq.state.or.us/wq/uic/uic.htm for more information. Detention ponds shall be designed to limit runoff to pre-development rates for the 2 through 25-year storm events. *This form shall be included as an attachment, inside the front cover, of the stormwater study. For Official Use Only: As the engineer of record, I hereby certify the above required items are complete and included with the submitted stormwater study and plan set. Signature Date . * IMPORTANT: ENGINEER PLEASE READ BELOW AND SIGN! www.wilson-architecture.com | 541-912-0878 Memo Project: Rosboro Plant Upgrades Subject: Site Review Application Project Description Date: February 25, 2024 From: Curt Wilson, AIA Project Summary Rosboro intends to upgrade their glulam beam manufacturing capacity at their plant on Main Street west of 28 th Street. The upgrades include a new Planer Mill building at the current location of the former Plywood Building, and a new Glulam Beam building in the area of the former Dow Corning site. Site The mill site is currently comprised of three tax lots, and the site is zoned HI – Heavy Manufacturing and Production. The uses of the proposed new buildings are consistent with current site uses. Other elements of the plant will remain as is, including the staff parking lot that extends from 21 st Street and the internal circulation system from flows from the 21st Street extension to access points along 28 th Street. Utilities such as power, water, sanitary, and storm will connect to existing utilities on the site. This site is located in the Ten to Twenty Year Time of Travel Zone in the 16th and Q Wellhead Protection Zone. We anticipate submitting the Site Review application February 2024. There are currently 320 marked vehicle spaces on the site for employees and visitors. 11 of these spaces are available to visitors in the north parking lot between Main Street and the main office building. As noted above, an additional 10 spaces will be added for customers at the east end of the City of Springfield Site Review Application Rosboro Plant Upgrades Wilson Architecture 2/25/2024 Page 2 Glulam Building. There are 309 spaces for staff parking, which is significantly more than the largest shift, therefore we do not plan to add parking spaces for employees. The proposed Glulam Building will span across two lots that are part of the overall plant site of the three total contiguous lots. Our proposed lot line consolidation process is as follows: Rosboro to propose a recordable Deed Restriction stating that “Parcel 1 and Parcel 2 of Reception No. 2016-060691 cannot be made separate transferrable parcels of land due to a structure encompassing both parcels, unless the building is removed and express permission to separate the parcels is given by the City of Springfield”. As an addition to this, as it is desired that the “Tax Lots” for these 2 parcels are combined into one “Tax Lot”, eliminating that “Tax Lot” line shown on your screenshot below, then Lane County has a Tax Lot Consolidation process. We acknowledge that when the Consolidation is done, the “legal lot” line does still exist. DWP Containment Requirements (SDC 3.3.200). The lamination process incorporates adhesives, therefore modest quantities will be stored on site and incorporated in the manufacturing equipment process (the equipment vendor selection process is ongoing, therefore Rosboro isn’t ready to commit to an adhesive type yet). An existing 48” sanitary line extends along the south edge of the west end of the property, and continues south presumably to serve properties along F St. Our survey indicates an easement at a manhole where the SS changes direction to the south. We intend to connect directly to the existing 48” SS on the property. Bike parking will be provided for staff within each building. Planer Mill The Planer Mill is approximately 72,000 sf. The building will be a Pre-Engineered Metal Building (Type II), fully sprinklered, one-story building. The building will be separated from other building on the site by 60 ft or more and located approximately 40 ft from the south property line abutting the railroad corridor. City of Springfield Site Review Application Rosboro Plant Upgrades Wilson Architecture 2/25/2024 Page 3 A few offices, restrooms, and staff break area will be constructed within the middle area of the building. The building will house manufacturing equipment to size and surface rough lumber into finished lumber that will be used in glulam beams. Some of the equipment will be accessed from elevated platforms located more than 8 ft above the building slab-on-grade. The elevated platform will support a few partially occupied spaces including an enclosed equipment operator control room. The occupied spaces will be conditioned, therefore the enclosure around the occupied spaces will be insulated. The remainder of the Planer Mill will not be conditioned and open to the elements at the primary access locations. We anticipate submitting the building permit application in May 2024. Glulam Building The Glulam Building is approximately 150,000 sf. The building will be a Pre-Engineered Metal Building (Type II), fully sprinklered, one-story building. The building will be separated from other buildings on the site by 60 ft or more and located approximately 40 ft from the south property line abutting the railroad corridor. A portion of the building is envisioned as a showcase for glulam beams and mass timber construction. The concept is a covered entrance, tall-volume lobby with open stairs to an enclosed mezzanine level with a meeting room (less than 750 sf) and a modest executive office suite. The engineered wood products, including glulam beams, decking, and wood stair elements would be exposed highlighting various connection methods and bathed in daylight. Approximately 10 parking spaces will be located at the east end of the building for customer meetings held at the Glulam building executive meeting room. One accessible parking space and loading zone will be located closest to the entrance. We anticipate submitting the building permit application in August 2024. SLIM17FAFC150/MVS Need help? Tech help line: (888) 722-1000 Email: sales@rablighting.com Website: www.rablighting.com Copyright © 2024 RAB Lighting All Rights Reserved Note: Specifications are subject to change at any time without notice Page 1 of 3 Color: Bronze Weight: 11.2 lbs Project:Type: Prepared By:Date: Driver Info Type Constant Current 120V 1.60A 208V 1.00A 240V 0.80A 277V 0.60A Input Watts 154.7/155.9/153.2W LED Info Watts 150W Color Temp 3000K/4000K/5000K Color Accuracy 80 CRI L70 Lifespan 100,000 Hours Lumens 18630/22217/19327 lm Efficacy 120.4/142.5/126.2 lm/W Technical Specifications Field Adjustability Field Adjustable: Color temperature selectable by 3000K, 4000K and 5000K Compliance UL Listed: Suitable for wet locations IESNA LM-79 & LM-80 Testing: RAB LED luminaires and LED components have been tested by an independent laboratory in accordance with IESNA LM-79 and LM-80. IP Rating: Ingress protection rating of IP65 for dust and water Performance Lifespan: 100,000-Hour LED lifespan based on IES LM-80 results and TM-21 calculations Wattage Equivalency: Equivalent to 750W Metal Halide LED Characteristics LEDs: Long-life, high-efficiency, surface-mount LEDs Electrical Driver: Constant Current, Class 1, 120-277V, 50/60 Hz, 120V: 1.60A, 208V: 1.00A, 240V: 0.80A, 277V: 0.60A Dimming Driver: Driver includes dimming control wiring for 0-10V dimming systems. Requires separate 0-10V DC dimming circuit. Dims down to 10%. Photocell: 120-277V selectable photocell that can be turned on and off. Surge Protection: L-N:6KV,L-PE:6KV,N-PE:6KV Construction Cold Weather Starting: The minimum starting temperature is -40°C (-40°F) Ambient Temperature : Max Power Temp Rating: 50°C (122°F) Middle Power Temp Rating: 50°C (122°F)) Low Power Temp Rating: 50°C (122°F) Housing: Precision die-cast aluminum housing and door frame Lens: Polycarbonate lens Mounting: Hinged wiring access and conduit entries on the back, sides, top and bottom make installation a snap Cut Off: Full cutoff (0°) Finish: Formulated for high durability and long-lasting color Green Technology: Mercury and UV free. RoHS-compliant components. Other Note: All values are typical (tolerance +/- 10%) 5 Yr Limited Warranty: The RAB 5-year, limited warranty covers light output, driver performance and paint finish. RAB's warranty is subject to all terms and conditions found at rablighting.com/warranty. SLIM17FAFC150/MVS Need help? Tech help line: (888) 722-1000 Email: sales@rablighting.com Website: www.rablighting.com Copyright © 2024 RAB Lighting All Rights Reserved Note: Specifications are subject to change at any time without notice Page 3 of 3 Dimensions Features Selectable CCT Full cutoff Selectable on/off photocell 0-10V dimming, standard Ordering Matrix Family Style Wattage Color Temp Finish Voltage Options SLIM17FA FC 150 /MVS FC = Full cutoff 40 = 40W 60 = 60W 100 = 100W 120 = 120W 150 = 150W Blank = 3000K/4000K/5000K CCT Adjustable Blank = Bronze Blank = 120-277V Blank = Selectable On/Off Photocell /MVS = Selectable On/Off Photocell w/ Microwave Occupancy Sensor SLIM17FAFC60 Need help? Tech help line: (888) 722-1000 Email: sales@rablighting.com Website: www.rablighting.com Copyright © 2024 RAB Lighting All Rights Reserved Note: Specifications are subject to change at any time without notice Page 1 of 2 Color: Bronze Weight: 7.1 lbs Project:Type: Prepared By:Date: Driver Info Type Constant Current 120V 0.50A 208V 0.40A 240V 0.30A 277V 0.25A Input Watts 57.9/58.4/57.2W LED Info Watts 60W Color Temp 3000K/4000K/5000K Color Accuracy 80 CRI L70 Lifespan 100,000 Hours Lumens 7035/8190/7251 lm Efficacy 121.6/140.3/126.7 lm/W Technical Specifications Field Adjustability Field Adjustable: Color temperature selectable by 3000K, 4000K and 5000K Compliance UL Listed: Suitable for wet locations IESNA LM-79 & LM-80 Testing: RAB LED luminaires and LED components have been tested by an independent laboratory in accordance with IESNA LM-79 and LM-80. IP Rating: Ingress protection rating of IP65 for dust and water DLC Listed: This product is listed by Design Lights Consortium (DLC) as an ultra-efficient premium product that qualifies for the highest tier of rebates from DLC Member Utilities. Designed to meet DLC 5.1 requirements. DLC Product Code: PLMK5TZVA46N Performance Lifespan: 100,000-Hour LED lifespan based on IES LM-80 results and TM-21 calculations Wattage Equivalency: Equvalent to 350W Metal Halide LED Characteristics LEDs: Long-life, high-efficiency, surface-mount LEDs Electrical Driver: Constant Current, Class 2, 120-277V, 50/60 Hz, 120V: 0.50A, 208V: 0.40A, 240V: 0.30A, 277V: 0.25A Dimming Driver: Driver includes dimming control wiring for 0-10V dimming systems. Requires separate 0-10V DC dimming circuit. Dims down to 10%. Photocell: 120-277V selectable photocell that can be turned on and off. Surge Protection: L-N:4KV,L/N-GND:4KV Construction Cold Weather Starting: The minimum starting temperature is -40°C (-40°F) Ambient Temperature : Max Power Temp Rating: 50°C (122°F) Middle Power Temp Rating: 50°C (122°F)) Low Power Temp Rating: 50°C (122°F) Housing: Precision die-cast aluminum housing and door frame Lens: Polycarbonate lens Mounting: Hinged wiring access and conduit entries on the back, sides, top and bottom make installation a snap Cut Off: Full cutoff (0°) Finish: Formulated for high durability and long-lasting color Green Technology: Mercury and UV free. RoHS-compliant components. Other Note: All values are typical (tolerance +/- 10%) SLIM17FAFC60 Need help? Tech help line: (888) 722-1000 Email: sales@rablighting.com Website: www.rablighting.com Copyright © 2024 RAB Lighting All Rights Reserved Note: Specifications are subject to change at any time without notice Page 2 of 2 Technical Specifications (continued) 5 Yr Limited Warranty: The RAB 5-year, limited warranty covers light output, driver performance and paint finish. RAB's warranty is subject to all terms and conditions found at rablighting.com/warranty. Buy American Act Compliance: RAB values USA manufacturing! Upon request, RAB may be able to manufacture this product to be compliant with the Buy American Act (BAA). Please contact customer service to request a quote for the product to be made BAA compliant. Dimensions Features Selectable CCT Full cutoff Selectable on/off photocell 0-10V dimming, standard Ordering Matrix Family Style Wattage Color Temp Finish Voltage Options SLIM17FA FC 60 FC = Full cutoff 40 = 40W 60 = 60W 100 = 100W 120 = 120W 150 = 150W Blank = 3000K/4000K/5000K Adjustable Blank = Bronze Blank = 120-277V Blank = Selectable On/Off Photocell /MVS = Selectable On/Off Photocell w/ Microwave Occupancy Sensor No liability is assumed hereunder until policy has been issued and full policy premium has been paid. MAIN OFFICE 811 WILLAMETTE ST. EUGENE, OREGON 97401 PH: (541) 687-2233 * FAX: (541)485-0307 E-MAIL: INFO@CASCADETITLE.COM FLORENCE OFFICE 715 HWY 101 *FLORENCE, OREGON 97439 MAILING:PO BOX 508 * FLORENCE, OREGON 97439 PH: (541) 997-8417 * FAX: (541)997-8246 E-MAIL: FLORENCE@CASCADETITLE.COM VILLAGE PLAZA OFFICE 4750 VILLAGE PLAZA LOOP SUITE 100 EUGENE, OREGON 97401 PH: (541) 653-8622 * FAX: (541) 844-1626 E-MAIL: VILLAGEPLAZA@CASCADETITLE.COM PRELIMINARY TITLE REPORT AMENDED ROSBORO March 31, 2016 ATTN: RICH BABCOCK Report No: 0294227 P.O. BOX 20 Your No: MILL SITE SPRINGFIELD, OR 97477 Seller: ROSBORO EMAIL: RICHBABCOCK@ROSBORO.COM Buyer: TO COME PRELIMINARY REPORT FOR: Owner's Standard Policy $T/C PREMIUMS: Owner's Standard Premium $T/C Gov. Lien/Inspect Fee $35.00 Temporary Billing $225.00 We are prepared to issue 2006 (6/17/06) ALTA title insurance policy(ies)of CHICAGO TITLE INSURANCE COMPANY,in the usual form insuring the title to the land described as follows: ( A T T A C H E D ) Vestee: ROSBORO, LLC, AN OREGON LIMITED LIABILITY COMPANY, who acquired title as ROSBORO LUMBER CO.; ROSBORO LUMBER COMPANY; ROSBORO LUMBER COMPANY, A PARTNERSHIP; ROSBORO LUMBER COMPANY, A CO-PARTNERSHIP; ROSBORO LUMBER CO., A CORPORATION; and ROSBORO LUMBER COMPANY, A CORPORATION, as its interests may appear of record, as to Parcels 1, 4, 5, 6 and 7; ROSBORO LAND ANNEX, LLC, AN OREGON LIMITED LIABILITY COMPANY, as to Parcels 2 and 3, and the Heirs or Devisees to THE ESTATE OF LOTTIE A. ZERBST, deceased as to Parcel 8 Estate:FEE SIMPLE DATED AS OF: FEBRUARY 16, 2016 at 8:00 A.M. *0294227* Order No. 0294227 Page 2 Schedule B of the policy(ies) to be issued will contain the following general and special exceptions unless removed prior to issuance: GENERAL EXCEPTIONS (Standard Coverage Policy Exceptions): 1.Taxes or assessments which are not shown as existing liens by the records of any taxing authority that levies taxes or assessments on real property or by the Public Records; proceedings by a public agency which may result in taxes or assessments, or notices of such proceedings, whether or not shown by the records of such agency or by the Public Records. 2.Facts, rights, interests or claims which are not shown by the Public Records but which could be ascertained by an inspection of the Land or by making inquiry of persons in possession thereof. 3.Easements, or claims of easement, not shown by the Public Records; reservations or exceptions in patents or in Acts authorizing the issuance thereof; water rights, claims or title to water. 4.Any encroachment, encumbrance, violation, variation, or adverse circumstance affecting the Title that would be disclosed by an accurate and complete land survey of the Land. 5.Any lien, or right to a lien, for services, labor, material, equipment rental or workers compensation heretofore or hereafter furnished, imposed by law and not shown by the Public Records. SPECIAL EXCEPTIONS: 6.Rights of the public in streets, roads and highways. 7.Easements, notes, conditions and restrictions shown, set forth, and/or delineated on the recorded Plat of Railroad Addition to Springfield. 8.Power line easements, including the terms and provisions thereof, granted Mountain States Power Co., by instrument recorded June 17, 1939, in Book 200, Page 272, Lane County Oregon Deed Records. (Parcel 1) 9.Subject to the terms and provisions of the easements set forth in instrument between the City of Springfield, a Municipal corporation in Lane County, Oregon, and Rosboro Lumber Co., recorded September 29, 1939, in Book 200, Page 522, Lane County Oregon Deed Records. (Parcel 1) 10.Easements for utilities over and across the premises formerly included within the boundaries of the alleys in Blocks 1, 2, 3, 4, 12 through 18 inclusive, and along the Southerly boundary of said plat; 21st, 22nd, 23rd, 24th, 25th, 26th and 27th Streets, South A Street, et al, now vacated, if any such exist, or as may be as reserved by Vacation Orders recorded January 3, 1940, in Book 202, Page 189; recorded August 23, 1941, in Book 220, Page 161; recorded June 25, 1947, in Book 350, Page 370 and recorded May 12, 1944, in Book 267, Page 410; Vacation Ordinance No. 1876, recorded November 22, 1963, Reception No. 34153; Ordinance No. 1875, recorded November 22, 1963, Reception No. 34154, Lane County Oregon Deed Records; Ordinance No. 3048, recorded August 30, 1974, Reception No. 7437722; Ordinance No. 5605, recorded April 8, 1992, Reception No. 9218984 and Ordinance No. 5770, recorded February 28, 1995, Reception No. 9511867, Lane County Official Records. (Parcels 1 and 8) 11.Power line easements, including the terms and provisions thereof, granted Mountain States Power Co., by instrument recorded January 29, 1940, in Book 199, Page 590, Lane County Oregon Deed Records. (Parcel 1) Order No. 0294227 Page 3 12.Easement Agreement dated January 09, 1946, including the terms and provisions thereof, between Oregon Fibre Flas Growers Association and Reconstruction Finance Corporation, covering water line; recorded June 18, 1946,in Book 323, Page 264, Lane County Oregon Deed Records. (Parcels 1, 2 and 3) 13.Easement Agreement dated February 26, 1946, including the terms and provisions thereof, between W. Paul Clarke and W. N. Gonyea, doing business as W. Paul Clarke and Clear Fir Sales Company and Reconstruction Finance Corporation, covering sewer lines; recorded June 18, 1946,in Book 323, Page 270, Lane County Oregon Deed Records. (Parcels 1, 2 and 3) 14.Easement Agreement dated February 09, 1946, including the terms and provisions thereof, between Springfield Plywood Corporation and Reconstruction Finance Corporation, recorded June 18, 1946,in Book 323, Page 277, Lane County Oregon Deed Records. (Parcels 1, 2 and 3) 15.Easement Agreement dated October 08, 1945, including the terms and provisions thereof, between the City of Springfield and Reconstruction Finance Corporation covering water pipe line from Booth-Kelly Lumber Company's mill race to plant site, recorded June 18, 1946,in Book 323, Page 285, Lane County Oregon Deed Records. (Parcels 1, 2 and 3) 16.Easement Agreement dated October 03, 1945, including the terms and provisions thereof, between Willamette Valley Wood Chemical Company and Reconstruction Finance Corporation, covering sewer line; recorded June 18, 1946,in Book 323, Page 290, Lane County Oregon Deed Records. (Parcels 1, 2 and 3) 17.Easement Agreement dated October 08, 1945, including the terms and provisions thereof, between the City of Springfield and Reconstruction Finance Corporation covering sewer line across certain parcels of land and streets owned by City of Springfield to a certain point on the Booth-Kelly Lumber Company's mill race; recorded June 18, 1946,in Book 323, Page 297, Lane County Oregon Deed Records. (Parcels 1, 2 and 3) 18.Easement as disclosed in Quitclaim Deed, including the terms and provisions thereof, between J. M. Bigham and Viola Marie Bigham, husband and wife, and Elmer Smith and Minnie Smith, husband and wife, recorded January 4, 1947, in Book 338, Page 688, Lane County Oregon Deed Records. (Parcel 1) 19.Conditions and Restrictions in Warranty Deed, including the terms and provisions thereof, (but omitting covenants or restrictions, if any, based upon race, color, religion, sex, sexual orientation, familial status, marital status, disability, handicap, national origin, ancestry, or source of income, as set forth in applicable state or federal laws, except to the extent that said covenant or restriction is permitted by applicable law) recorded March 26, 1948, in Book 315, Page 279, and modified by instrument recorded October 11, 1962, Reception No. 86405, and recorded October 22, 1962, Reception No.87429, Lane County Oregon Deed Records. (Parcel 1) 20.Power line easement, including the terms and provisions thereof, conveyed to the City of Springfield, by instrument recorded August 14, 1950, in Book 421, Page 196, Lane County Oregon Deed Records. (Parcel 1) 21.Right of Way Easement, including the terms and provisions thereof, granted the City of Springfield, by instrument recorded August 29, 1950, in Book 422, Page 376, Lane County Oregon Deed Records. (Parcel 1) 22.Easement for Right of Way Pipe Line, including the terms and provisions thereof, granted Mountain States Power Company, by instrument recorded October 26, 1951, in Book 448, Page 18, Lane County Oregon Deed Records. (Parcel 1) Order No. 0294227 Page 4 23.Easement Agreement dated November 01, 1945, including the terms and provisions thereof, between the Southern Pacific Company and Reconstruction Finance Corporation, covering both water pipe and sewer pipe crossing under railroad tracks; recorded December 22, 1951, in Book 451, Page 182, Lane County Oregon Deed Records. (Parcels 1, 2 and 3) 24.Easement for transmission lines and access roads, including the terms and provisions thereof, granted the United States of America, by instrument recorded June 5, 1952, Reception No. 76367, Lane County Oregon Deed Records, and amended by instrument recorded August 31, 1998, Reception No. 9869349,Lane County Official Records. (Parcels 1, 2 and 3) 25.Reservations and easements set forth in deed from the City of Springfield, to Apex Smelting Co., including the terms and provisions thereof, dated October 03, 1952, recorded October 06, 1952, Reception No. 86863, Lane County Oregon Deed Records. (Parcels 1, 2 and 3) 26.Easement for Pipe Line Right of Way, including the terms and provisions thereof, granted Mountain States Power Company, by instrument recorded March 3, 1954, Reception No. 24287, Lane County Oregon Deed Records. (Parcel 1) 27.Easement for Pipe Line Right of Way, including the terms and provisions thereof, granted Mountain States Power Company, by instrument recorded May 3, 1954, Reception No. 24288, Lane County Oregon Deed Records. (Parcel 1) 28.Reservation of fissionable material, including the terms and provisions thereof, by the United States of America, in deed to Learner Investment Corporation, recorded January 19, 1955, Reception No. 47486, Lane County Oregon Deed Records. (Parcels 1, 2 and 3) 29.Subject to the terms and provisions for Reservation of easement for sewer, as set forth in instrument recorded November 12, 1959, Reception No. 83150, Lane County Oregon Deed Records. (Parcel 5) 30.Easement for pipeline, including the terms and provisions thereof, as granted to Northwest Natural Gas Company, by instrument recorded September 19, 1961, Reception No. 44351, Lane County Oregon Deed Records. (Parcels 1, 2 and 3) 31.Access Restrictions, including the terms and provisions thereof, contained in deed from Rosboro Lumber Company, a co-partnership, to the State of Oregon, by and through its State Highway Commission, recorded August 5, 1965, Reception No. 13773, Lane County Oregon Deed Records. (Parcel 1) 32.Easement, including the terms and provisions thereof, granted the City of Springfield, recorded June 2, 1966, Reception No. 49420, Lane County Official Records. (Parcel 1) 33.Slope and storm drain easement, including the terms and provisions thereof, granted the State of Oregon, by and through its State Highway Commission, by instrument recorded August 11, 1966, Clerk's File No. 57287, Lane County Oregon Deed Records. (Parcel 1) 34.Easement for powerlines, including the terms and provisions thereof, as granted to the City of Springfield, by instrument recorded March 18, 1974, Reception No. 7410273, Lane County Official Records. (Parcels 2 and 3) 35.Option, including the terms and provisions thereof, granted the City of Springfield in consideration of the vacation of a part of 22nd Street, recorded August 30, 1974, Reception No. 7437723, Lane County Official Records. (Parcel 1) 36.Improvement Agreement, including the terms and provisions thereof, between the City of Springfield, and Rosboro Lumber Company, recorded August 20, 1976, Reception No. 7643315, Lane County Official Records. (Parcel 1) Order No. 0294227 Page 5 37.Matters disclosed by survey of the subject property prepared by Stephen H. Ford, Inc., Project No. 774.5, dated September, 1980, including but not limited to unrecorded easements, spur track and/or any encroachments. Any claim arising therefrom is hereby excepted. (Parcels 2 and 3) 38.Set-back easement, including the terms and provisions thereof, granted by Kawecki Berylco Industries, Inc., a corporation, to Rosboro Lumber Company, a partnership, dated February 10, 1975, recorded September 25, 1980, Reception No. 8048057, Lane County Official Records. (Parcels 2 and 3) 39.Easement for pedestrian and vehicular access, including the terms and provisions thereof, granted Beverly Jo Saxon, by instrument recorded February 13, 1992, Reception No. 9208653, Lane County Official Records. (Parcel 1) 40.Easements as disclosed in Bargain and Sale Deed, including the terms and provisions thereof, between the City of Springfield, Oregon, a municipal corporation, and Rosboro Lumber Company, recorded June 4, 1993, Reception No. 9334199, Lane County Official Records. (Parcel 1) 41.Easement, including the terms and provisions thereof, granted the City of Springfield, a municipal corporation, in Lane County, by instrument recorded June 6, 1997, Reception No. 9738498, Lane County Official Records. (Parcels 2 and 3) 42.State of Oregon Well Ownership Information Form, including the terms and provisions thereof, recorded September 17, 2001, Reception No. 2001-060622, Lane County Deeds and Records, containing Well Identification No. L47824. (Parcel 1) 43.Improvement Agreement, Including Notice of Potential Assessment Lien, including the terms and provisions thereof, dated January 19, 2004, between the City of Springfield, and Rosboro Lumber Company, recorded January 30, 2004, Reception No. 2004-006557, Lane County Deeds and Records. (Parcel 1) 44.An Ordinance Approving the Springfield Downtown Urban Renewal Plan and Report; Ordinance No. 6210, including the terms and provisions thereof, recorded December 7, 2007, Reception No. 2007-081042, Lane County Deeds and Records. 45.Easement, including the terms and provisions thereof, in favor of Qwest Communications Company, LLC, Level 3 Communications, LLC and/or WilTel Communications, LLC, for permanent telecommunications right of way and related facilities ("Telecommunications Cable System"), as set forth in Final Order and Judgment approving the Settlement Agreement, filed July 11, 2013, in the United States District Court for the District of Oregon, Eugene Division, Case No. 6:00-cv-06201-AA: Easement Deed by Court Order in Settlement of Landowner Action was recorded September 12, 2013, Reception No. 2013-049553, and recorded January 09, 2014, Reception No. 2014-000678, Lane County Deeds and Records. (Parcels 1 and 2) 46.The rights of tenants holding under unrecorded leases. 47.This report does not include a search for financing statements filed in the office of the Secretary of State, or in a County other than the County wherein the premises are situated, and no liability is assumed if a financing statement is filed in the office of the County Clerk covering fixtures, equipment and/or personal property on the premises wherein the lands are described other than by metes and bounds or under the rectangular survey system. Order No. 0294227 Page 6 NOTE: The property address as shown on the Assessor's Roll is: 211 South 21st Street Springfield, OR 97477 (Parcel 1) 2027, 2105 and 2219 South A Street Springfield, OR 97477 (Parcel 1) 2509 Main Street Springfield, OR 97477 (Parcel 1) 1801 Aster Street Springfield, OR 97477 (Parcel 3) 170 South 21st Street Springfield, OR 97477 (Parcel 6) 156 South 20th Street Springfield, OR 97477 (Parcel 7) NOTE: Taxes, Account No. 0318103, Assessor's Map No. 17 03 36, #100, Code 19-00, 2015-2016, in the amount of $129,382.24, PAID IN FULL. (Parcels 1 and 8) Taxes, Account No. 1814399, Assessor's Map No. 17 03 36, #100, Code 19-99, 2015-2016, in the amount of $10,602.73, PAID IN FULL. (Land Only) (Parcels 1 and 8) Taxes, Account No. 1851250, Assessor's Map No. 17 03 36, #100-901, Code 19-00, 2015-2016, in the amount of $435,282.60, PAID IN FULL. (Improvements Only) (Parcel 1) Taxes, Account No. 1054475, Assessor's Map No. 17 03 36, #401, Code 19-99, 2015-2016, in the amount of $12,534.16, PAID IN FULL. (Parcel 2) Taxes, Account No. 1454006, Assessor's Map No. 17 03 36, #401-902, Code 19-99, 2015-2016, in the amount of $20.85, PAID IN FULL. (Improvements only assessed to Suburban Propane) (Parcel 2) Taxes, Account No. 1853579, Assessor's Map No. 17 03 36, #401-903, Code 19-99, 2015-2016, in the amount of $6.09, PAID IN FULL. (Improvements only assessed to Suburban Propane) (Parcel 2) Taxes, Account No. 0318129, Assessor's Map No. 17 03 36, #300, Code 19-99, 2015-2016, in the amount of $20,278.80, PAID IN FULL. (Parcel 3) Taxes, Account No. 1851268, Assessor's Map No. 17 03 36, #300-901, Code 19-99, 2015-2016, in the amount of $1,236.66, PAID IN FULL. (Improvement Only) (Parcel 3) Taxes, Account No. 0333425, Assessor's Map No. 17 03 36 4 2, #6000, Code 19-99, 2015-2016, in the amount of $641.22, PAID IN FULL. (Land Only) (Parcel 4) Taxes, Account No. 0333391, Assessor's Map No. 17 03 36 4 2, #5700, Code 19-99, 2015-2016, in the amount of $223.20, PAID IN FULL. (Land Only) (Parcel 5) Taxes, Account No. 0333359, Assessor's Map No. 17 03 36 4 2, #5300, Code 19-99, 2015-2016, in the amount of $293.71, PAID IN FULL. (Land Only) (Parcel 6) Taxes, Account No. 0333367, Assessor's Map No. 17 03 36 4 2, #5400, Code 19-99, 2015-2016, in the amount of $3,219.01, PAID IN FULL. (Parcel 6) Taxes, Account No. 0333342, Assessor's Map No. 17 03 36 4 2, #5200, Code 19-99, 2015-2016, in the amount of $885.04, PAID IN FULL. (Land Only) (Parcel 7) NOTE: A judgment search has been made on the above named Vestee(s), and we find NONE except as set forth above. NOTE: According to the public record, the following deed(s) affecting the property herein described have been recorded within 24 months of the effective date of this report: NONE Order No. 0294227 Page 7 NOTE: This report is being amended to correct exception nos. 10, 30 and 45. NOTE: The policy to be issued may contain an arbitration clause. When the Amount of Insurance is less than the amount, if any, set forth in the arbitration clause, all arbitrable matters shall be arbitrated at the option of either the Company or the Insured as the exclusive remedy of the parties. This report is preliminary to the issuance of a policy of title insurance and shall become null and void unless a policy is issued and the full premium paid. Cascade Title Co. sm: Title Officer: DEBBIE FORSTROM Cc:KUI BEYMER EMAIL: KUIBEYMER@ROSBORO.COM Order No. 0294227 Page 8 PROPERTY DESCRIPTION PARCEL 1: Beginning at the Southeast corner of that tract of land described in deed to Kawecki Berylco Industries, Inc., recorded February 12, 1973, Reception No. 7306198, Lane County Official Records, said point being on the North line of the Southern Pacific Railroad and North 89° 56' 30" East 493.54 feet and South 0° 01' East 1003.74 feet from the Southwest corner of RAILROAD ADDITION TO SPRINGFIELD, as platted and recorded in Book 7, Page 17, Lane County Oregon Plat Records; thence North 0° 01' West 933.44 feet to a point on the South line of that tract of land described in deed to Rosboro Lumber Company recorded June 4, 1993, Reception No. 9334199, Lane County Official Records; thence South 89° 56 1/2' West 337.79 feet to the Southwest corner of said Rosboro Lumber Company tract; thence Northerly 70.3 feet, more or less, to the Northwest corner of said Rosboro Lumber Company tract, said point being on the South line of said RAILROAD ADDITION TO SPRINGFIELD; thence Easterly along the South line of said RAILROAD ADDITION TO SPRINGFIELD 466 feet, more or less, to the Southwest corner of that certain vacated alley lying along the South line of said RAILROAD ADDITION TO SPRINGFIELD, as described in vacation proceedings recorded April 8, 1992, Reception No. 9218984, Lane County Official Records; thence continue North along the West line of Lot 5, Block 12, of said Railroad Addition and the Southerly extension of said line, 136 feet to the Northwest corner of said Lot 5, Block 12; thence Easterly along the North lines of Blocks 12, 13 and 14, and the extension of said line, 790 feet to the Northwest corner of Lot 9, Block 15, said RAILROAD ADDITION TO SPRINGFIELD, thence Northerly along the West line of Block 4, said RAILROAD ADDITION TO SPRINGFIELD, and the extension of said line 194 feet to the center of the vacated alley running East and West through said Block 4; thence Easterly along the center line of said alley, and its Easterly extension, 313 feet to the intersection thereof with the center line of vacated 25th Street; thence Northerly along the center line of said vacated 25th Street 128 feet to the North line of Block 3, extended Westerly, of said vacated RAILROAD ADDITION TO SPRINGFIELD; thence Easterly along the North line of Blocks 3, 2 and 1, and the extension of said lines 918.8 feet, more or less, to the Northeast corner of Block 1, said RAILROAD ADDITION TO SPRINGFIELD; thence South along the East line of said RAILROAD ADDITION TO SPRINGFIELD, and the Easterly line of that tract of land described in deed to Rosboro Lumber Co., recorded July 15, 1939, in Book 200, Page 326, Lane County Oregon Deed Records, to the North line of the Southern Pacific Railroad; thence Westerly along the North line of said railroad to the point of beginning, in Lane County, Oregon. ALSO: Lots 3, 4 and 5, Block 12, RAILROAD ADDITION TO SPRINGFIELD, as platted and recorded in Book 7, Page 17, Lane County Oregon Plat Record, in Lane County, Oregon, together with that portion of the vacated alley inuring to said lots on the South, by operation of law, under vacation Ordinance No. 5605, recorded April 8, 1992, Reception No. 9218984, Lane County Official Records, in Lane County, Oregon. EXCEPTING THEREFROM: Those portions conveyed to Lane County, Oregon, by instruments recorded March 15, 1929, in Book 162, Pages 225-226, and recorded March 21, 1929, in Book 164, Page 30, Lane County Oregon Deed Records, in Lane County, Oregon. ALSO EXCEPTING THEREFROM: That portion conveyed to the City of Springfield by deed recorded March 18, 1964, Reception No. 48012, Lane County Oregon Deed Records, in Lane County, Oregon. Continue- Order No. 0294227 Page 9 Property Description Continued –(Parcel 1) ALSO EXCEPTING THEREFROM: That portion conveyed to the State of Oregon, by and through its State Highway Commission, in deed recorded September 16, 1966, Reception No. 61006, Lane County Oregon Deed Records, in Lane County, Oregon. ALSO EXCEPTING THEREFROM: The East 4 feet of Lot 8, Block 13, RAILROAD ADDITION TO SPRINGFIELD, as platted and recorded in Book 7, Page 17, Lane County Oregon Plat Records, together with that portion of the vacated alley inuring to said land on the South, by operation of law, under vacation Ordinance No. 5605, recorded April 8, 1992, Reception No. 9218984, Lane County Official Records, in Lane County, Oregon. PARCEL 2: Beginning at a point which is 493.54 feet North 89° 56' 30" East and 525.0 feet South 0° 01' East from the Southwest corner of the RAILROAD ADDITION to Springfield, as platted and recorded in Book 7, Page 17, Lane County Oregon Plat Records; running thence South 0° 01' East 478.74 feet to the North right of way line of the Southern Pacific Railroad; thence along said railroad right of way on a curve to the right, the chord of which bears North 81° 46' 28" West 601.95 feet; thence leaving said right of way line North 0° 01' West 391.99 feet; thence North 89° 56' 30" East 595.79 feet to the point of beginning, in Lane County, Oregon. PARCEL 3: Beginning at the Southwest corner of RAILROAD ADDITION to Springfield, as platted and recorded in Book 7, Page 17, Lane County Oregon Plat Records; thence North 89° 56 1/2' East 1043.24 feet along the South line of said RAILROAD ADDITION to a point; thence North 89° 56 1/2' East 4.51 feet along the South line of said RAILROAD ADDITION to Springfield, to a point in the center of a traveled road; thence South 0° 01' East 70.30 feet along the center line of said road to a point being the true point of beginning; thence South 89° 56 1/2' West 1305.45 feet to a point; thence South 0° 23' West 454.71 feet to a point; thence North 89° 56 1/2' East 158.62 feet to the Northwest corner of the Willamette Wood Chemical Company property; thence North 89° 56 1/2' East 1150.00 feet to a point in the center line of a traveled road; thence North 0° 01' West 454.70 feet along the center line of said traveled road to the true point of beginning, in Lane County, Oregon; EXCEPT: Beginning at a point which is 1047.75 feet North 89° 56' 30" East and 70.30 feet South 0° 01' East from the Southwest corner of RAILROAD ADDITION to Springfield, as platted and recorded in Book 7, Page 17, Lane County Oregon Plat Records, said point also being in the centerline of 22nd Street as located; running thence along said centerline South 0° 01' East 454.70 feet; thence South 89° 56' 30" West 554.21 feet; thence North 0° 01' West 454.70 feet; thence North 89° 56' 30" East 554.21 feet to the point of beginning, in Lane County, Oregon. PARCEL 4: Lots 13 through 18, inclusive, Block 5, RAILROAD ADDITION TO SPRINGFIELD, as platted and recorded in Book 7, Page 17, Lane County Oregon Plat Records, in Lane County, Oregon. Continued- Order No. 0294227 Page 10 Property Description Continued- PARCEL 5: The East 8 feet of Lot 13, all of lots 14 and 15, and the West 24 feet of Lot 16, Block 6, RAILROAD ADDITION TO SPRINGFIELD, as platted and recorded in Book 7,Page 17, Lane County Oregon Plat Records, in Lane County, Oregon. EXCEPTING THEREFROM: The North 60 feet thereof, in Lane County, Oregon. PARCEL 6: Lots 10, 11 and the West 24 feet of Lot 12, Block 7, RAILROAD ADDITION TO SPRINGFIELD, as platted and recorded in Book 7, Page 17, Lane County Oregon Plat Records, in Lane County, Oregon. ALSO: The East 8 feet of Lot 12, and Lots 13 through 18, inclusive, Block 7, RAILROAD ADDITION TO SPRINGFIELD, as platted and recorded in Book 7, Page 17, Lane County Oregon Plat Records, in Lane County, Oregon. PARCEL 7: Lots 12 through 18, inclusive, Block 8, RAILROAD ADDITION TO SPRINGFIELD, as platted and recorded in Book 7, Page 17, Lane County Oregon Plat Records, in Lane County, Oregon. PARCEL 8: The East 4 feet of Lot 8, Block 13, RAILROAD ADDITION TO SPRINGFIELD, as platted and recorded in Book 7, Page 17, Lane County Oregon Plat Records, together with that portion of the vacated alley inuring to said land on the South, by operation of law, under vacation Ordinance No. 5605, recorded April 8, 1992, Reception No. 9218984, Lane County Official Records, in Lane County, Oregon. BH-1BH-7BH-8BH-6BH-4BH-5BH-2BH-3200100SCALE IN FEET050BH-1BORING NUMBER AND LOCATIONLEGENDFoundation Engineering, Inc.Professional Geotechnical ServicesPROJECT NO.FIGURE NO.DRAWN BY:DATE:BORING LOCATIONSROSBORO PROJECTSPRINGFIELD, OREGONERIN22311102ADEC 2023Draft Capped with gravel Backfilled with bentonite chips Groundwater encountered during drilling SS-1-1 SS-1-2 SH-1-3 SS-1-4 SS-1-5 ASPHALTIC CONCRETE (±2 inches). Dense silty CRUSHED ROCK (GM); grey-brown, moist, ±2-inch minus angular rock, (base rock). Medium stiff silty CLAY (CH); brown and iron-stained, moist, medium to high plasticity, (Willamette Silt). Stiff below ±5 feet. Field vane on SH-1-3: Su= 0.74 tsf at ±7.5 feet. Very dense sandy GRAVEL, trace silt (GW); grey-brown and iron-stained, wet, fine to coarse sand, fine to coarse subrounded to rounded gravel, (alluvium). BOTTOM OF BORING 471.8 0.2 470.5 1.5 463.5 8.5 455.5 16.5 SPT N-Value Moisture (%)Groundwater Log Depth Depth and Comments Core Recovery (%) RQD (%) 0 50 100 Elev.Backfill/ Installations/(ft) Sample Number and Location Soil / Rock Description 2231110 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 BORING LOG: BH-1Project No.: Surface Elevation: Date of Boring: November 20, 2023 Rosboro Project Springfield, Oregon BH-1 Page 1 of 1 472.0 feet (Approx.) Professional Geotechnical Services Foundation Engineering, Inc. 6 10 67 65 6 10 67 65 ldh (1-10-2024) Draft Backfilled with bentonite chips No seepage or groundwater encountered during drilling S-2-1 SS-2-2 SS-2-3 SS-2-4 Dense CRUSHED GRAVEL (GP); grey, moist, up to ±1 to 2-inch diameter subrounded to rounded gravel, (fill). Stiff silty CLAY (CH); brown and iron-stained, wet, medium to high plasticity, (Willamette Silt). Very dense sandy GRAVEL, trace silt (GW); grey-brown, wet, fine to coarse sand, fine to coarse subrounded to rounded gravel, (alluvium). BOTTOM OF BORING 466.0 7.0 463.5 9.5 461.5 11.5 SPT N-Value Moisture (%)Groundwater Log Depth Depth and Comments Core Recovery (%) RQD (%) 0 50 100 Elev.Backfill/ Installations/(ft) Sample Number and Location Soil / Rock Description 2231110 1 2 3 4 5 6 7 8 9 10 11 1 2 3 4 5 6 7 8 9 10 11 BORING LOG: BH-2Project No.: Surface Elevation: Date of Boring: November 20, 2023 Rosboro Project Springfield, Oregon BH-2 Page 1 of 1 473.0 feet (Approx.) Professional Geotechnical Services Foundation Engineering, Inc. 43 9 73 43 9 73 ldh (1-10-2024) Draft Capped with crushed rock Backfilled with bentonite chips Groundwater encountered during drilling SS-3-1 SH-3-2 SS-3-3 SS-3-4 SS-3-5 SS-3-6 ASPHALTIC CONCRETE (±4 inches). Dense sandy GRAVEL (GP); grey, moist, ±2-inch minus subrounded to rounded gravel, (base rock). Stiff silty CLAY (CH); brown to dark brown and iron-stained, moist, medium to high plasticity, (Willamette Silt). Field vanes on SH-3-2: Su= 0.84 tsf at ±5 feet and Su= 0.46 tsf at ±7.5 feet. Some fine sand below ±7 feet. Sandy below ±11 feet. Dense to very dense sandy GRAVEL, trace silt (GW); wet, fine to coarse sand, fine to coarse subrounded to rounded gravel, (alluvium). BOTTOM OF BORING 472.7 0.3 471.0 2.0 460.5 12.5 451.5 21.5 SPT N-Value Moisture (%)Groundwater Log Depth Depth and Comments Core Recovery (%) RQD (%) 0 50 100 Elev.Backfill/ Installations/(ft) Sample Number and Location Soil / Rock Description 2231110 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 BORING LOG: BH-3Project No.: Surface Elevation: Date of Boring: November 20, 2023 Rosboro Project Springfield, Oregon BH-3 Page 1 of 1 473.0 feet (Approx.) Professional Geotechnical Services Foundation Engineering, Inc. 13 15 13 69 33 13 15 13 69 33 ldh (1-10-2024) Draft Capped with crushed rock Backfilled with bentonite chips Groundwater encountered during drilling SS-4-1 SS-4-2 SS-4-3 SS-4-4 SS-4-5 Dense CRUSHED ROCK (GP); grey, moist, ±2-inch minus angular rock, (fill). ±1-inch minus crushed rock below ±1.5 feet. SILT, some debris (ML); grey, moist, low to medium plasticity, debris consists of brick and concrete fragments, (fill). Very stiff silty CLAY (CH); dark brown, moist, medium to high plasticity, (Willamette Silt). Iron-stained from ±5 to 7 feet. Stiff and dark grey below ±7 feet. Very dense sandy GRAVEL, trace silt (GP); grey-brown, wet, fine to coarse sand, fine to coarse subrounded to rounded gravel, (alluvium). BOTTOM OF BORING 474.0 2.0 472.5 3.5 461.5 14.5 459.6 16.4 SPT N-Value Moisture (%)Groundwater Log Depth Depth and Comments Core Recovery (%) RQD (%) 0 50 100 Elev.Backfill/ Installations/(ft) Sample Number and Location Soil / Rock Description 2231110 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 BORING LOG: BH-4Project No.: Surface Elevation: Date of Boring: November 20, 2023 Rosboro Project Springfield, Oregon BH-4 Page 1 of 1 476.0 feet (Approx.) Professional Geotechnical Services Foundation Engineering, Inc. 30 19 10 9 96/11" 30 19 10 9 96/11" ldh (1-10-2024) Draft Capped with crushed gravel Backfilled with bentonite chips Groundwater encountered during drilling SS-5-1 SS-5-2 SS-5-3 SS-5-4 SS-5-5 Dense silty CRUSHED GRAVEL (GM); grey-brown, moist, low plasticity silt, ±2-inch minus, (fill). Blue-grey with scattered wood fibers below ±2 feet. Stiff silty CLAY (CH); dark brown, moist, medium to high plasticity, (Willamette Silt). Iron-stained below ±6 feet. Medium stiff to stiff below ±7 feet. Very dense sandy GRAVEL, trace silt (GW); grey, wet, fine to coarse sand, fine to coarse subrounded to rounded gravel, (alluvium). BOTTOM OF BORING 471.0 4.0 461.5 13.5 458.5 16.5 SPT N-Value Moisture (%)Groundwater Log Depth Depth and Comments Core Recovery (%) RQD (%) 0 50 100 Elev.Backfill/ Installations/(ft) Sample Number and Location Soil / Rock Description 2231110 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 BORING LOG: BH-5Project No.: Surface Elevation: Date of Boring: November 20, 2023 Rosboro Project Springfield, Oregon BH-5 Page 1 of 1 475.0 feet (Approx.) Professional Geotechnical Services Foundation Engineering, Inc. 31 12 9 6 91/11½" 31 12 9 6 91/11½" ldh (1-10-2024) Draft Capped with AC cold patch Backfilled with bentonite chips Groundwater encountered during drilling SH-7-1 SS-7-2 SS-7-3 SS-7-4 SS-7-5 SS-7-6 ASPHALTIC CONCRETE (±5 inches). Very dense CRUSHED ROCK (GP); grey, wet, ±3-inch minus angular rock, (base rock). Medium stiff silty CLAY, scattered organics (CH); grey-brown, moist, medium to high plasticity, organics consist of wood fragments, (fill). Field vanes on SH-7-1: Su= 0.46 tsf at ±2.5 feet and Su= 0.30 tsf at ±4 feet. Medium stiff silty CLAY (CH); brown and iron-stained, moist to wet, medium to high plasticity, (Willamette Silt). Soft, some fine sand, and grey mottling below ±10 feet. Dense to very dense sandy GRAVEL, trace silt (GW); grey, wet, fine to coarse sand, fine to coarse rounded gravel, (alluvium). BOTTOM OF BORING 474.6 0.4 473.0 2.0 471.0 4.0 464.0 11.0 453.5 21.5 SPT N-Value Moisture (%)Groundwater Log Depth Depth and Comments Core Recovery (%) RQD (%) 0 50 100 Elev.Backfill/ Installations/(ft) Sample Number and Location Soil / Rock Description 2231110 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 BORING LOG: BH-7Project No.: Surface Elevation: Date of Boring: December 4, 2023 Rosboro Project Springfield, Oregon BH-7 Page 1 of 1 475.0 feet (Approx.) Professional Geotechnical Services Foundation Engineering, Inc. 5 8 20 50/3" 43 5 8 20 50/3" 43 ldh (1-10-2024) Draft Capped with AC cold patch Backfilled with bentonite chips Groundwater encountered during drilling SS-8-1 SH-8-2 SS-8-3 SS-8-4 SS-8-5 SS-8-6 ASPHALTIC CONCRETE (±8 inches). Very dense sandy GRAVEL (GP); grey, wet, fine to coarse sand, fine to coarse subrounded to rounded gravel, (base rock). Soft to medium stiff silty CLAY, trace sand (CH); grey, wet, medium to high plasticity, fine sand, (fill). Medium stiff silty CLAY (CH); brown, moist, medium to high plasticity, (Willamette Silt). Field vanes on SH-8-2: Su= 0.72 tsf at ±5 feet and Su= 0.82 tsf at ±7.5 feet. Stiff and iron-stained below ±7.5 feet. Mottled grey and wet below ±10 feet. Very dense sandy GRAVEL, trace silt (GW); grey, wet, fine to coarse sand, fine to coarse rounded gravel, (alluvium). BOTTOM OF BORING 475.3 0.7 474.0 2.0 473.0 3.0 462.0 14.0 454.5 21.5 SPT N-Value Moisture (%)Groundwater Log Depth Depth and Comments Core Recovery (%) RQD (%) 0 50 100 Elev.Backfill/ Installations/(ft) Sample Number and Location Soil / Rock Description 2231110 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 BORING LOG: BH-8Project No.: Surface Elevation: Date of Boring: December 4, 2023 Rosboro Project Springfield, Oregon BH-8 Page 1 of 1 476.0 feet (Approx.) Professional Geotechnical Services Foundation Engineering, Inc. 7 11 14 60 54 7 11 14 60 54 ldh (1-10-2024) Draft PROJECT NAME:Bo5'=>FROJECT NO.Z,23 I S l 0" i 'i I, li I i i IIJ j. ia , j,Q I is Ii. 1- ' i. j 'i 'U) ,11,, ,.I i ii _, iiri : I i iI -z I T I , I I' S I 0 I.- %_ I _.. ' I _____L_______.._______._._.IJ i m a " i ' ' ' "- 7 a _ 1,'7- !9 i-=m, ! .! ai,._ 'i=!a <-8.K=i==;'bd ?' I._____._______j______._.L_.________..___i ' I i , il A' =-----"""a""-'-- ,, , , _ j _, i I I I I I I i I l i i a h. ,% I I'El e --- -f I (ij ,, 'A i J -'. c . . X 1p<' I i.ali 'al i 'i%J 'l'-.'q._- '%., -__ sea. 1 -V),! '2 4 '- ra-- ' - 'st % 'tJR ' .'P xi'!"="i I r ii fS'Ti -31 I r-r< 4r+_il 'Jta ' *.- '- i.,6 IA-- . ul k4 'a:,4 ,i -t ""4 l' P . .a, v; Yi -li . '- ._ ". _3 '_(yl%!yll,'i."'-u4"___ 4 ,Y % "E=(i" , 11 } >E ,.5";: !'-l;I il(: jpl I . I I I II , . . I Iri j: oi ss' y: c'!' I ' 4 I I.> I . . in . _ . ___ ..___:_ _____ '41 -jf' I " -7 K =tl)'r= : ,,,s;.l,4m')a_':,,,="" "-'-":--""--< - " i 'a ,:,: " 'It) . -, ,P> , 4 [1,';lf€rl 'pv>.)(_ :. , ,A,' . 3, :" qE %_+% -- . v" I l" I ' i:5- *1_,%,.,),: X'. r%"r" 6. o -,,s-%l . oli ta . A$ (j :l.i.S)"' 3i _ :'! I I I : I ' a : " 1. ,' z, '-""-'- i--'-'--- -- i - - , , I : : II I 1. :i i i I i i 1 I I ' ( ' l) I ' 1 ' I ' I ' I ' R " ' I " ' ! ' l : u4741nB 8 l ' 0 : I 's I 711111ii Foundation Engineering - Professional Ceotechnical Services itrM '/size BY DATE SHEET NO. IDraft PROJECT NAME:\PROJECTNO.22-31ttzI Ij 1 ia ., I a iI '& '- I s I Jii :'i-'i'<<4" ,l"n; A' I i . .' q ) -4 l:._l . (gI j k ," %'1:_,'=a'a__i.."'i'l ___. :. ..l<<111Liiba.)'q.,,.,,1"?a(% ., i; h F_ f i Th_,. _,, . ,." -4,'Ill, C'a, /j (Sl Q :("-"N 4 _____> ! ' _l I I _ _.._...... ...' ._..l . . _...... .. ..........._.% f ffi _ . . _ ,_' 0 ' i i -"'-'- '-- '-t' a' "-" i " ' -""'--"-- '-"""""' " ""-i" "I iI _a.2'.""' :. I%l ___ta!!'::.," ;,,'I'< I _l o' a'."J Ii ". tflF'. I l,, Ii Ik" ' (S' :s ,';J 'A : 21 : Iai 1,J, % .fi P I II! 2 - a 'o S " ,3 , I , i _ i I €1 a i. (s% , . g, ) , -_'i I , _ / j 'C- :!"' fl zs lJ:ii I I - I ;' W " - '!- '@ ""- . 'j-::%-- -4-l , il. ra %:} ' = 4'--' /i!_-a ;:2,' :,,% ,i -TG-1,6(C-"t :Q? %_;E- 1.-B 'l ' ,--- p 9 4 4'3Syl , 1% -, %l %1 17 4, iO G ji ! ;: -,, . ! ' -4 -hl Ii < -d,--71 l: :,( i I '!i : l,%,p,_ i f' . 1 ,,- 'a ki ', g w I} . ! '! . !,, ),J- _ -X.' II Th' t ' a ' l-' oa o t J ).J) ,,'s - ., ") 5 : o {.,, ' " ' ! ,3i '!' - i' ="-"' - u _,> s i i ' I : - j,:.__......_.-_.-.---.L-.++a*a'* ,l l $ , , .7aaa**aaa=-*a':I I B i" I : I .i. ( { ., i ( i i ia I ! l I : _ _ _i _ ,. _ : _ : _ _I _l I I i i . j. : I I : I ' i I , i I : (%) I " " 1. " ' I ' r ' I i t a I i I $%e r@ l : @ i a ', T ,illlllllllli Foundation Engineering Professional C;eotechnical Services M?'/s(v BY DATE SHEET NO. .1Draft Memorandum Page 1 of 1 800 Willamette Street, Suite 400, Eugene, OR 97401 541.684.4902 FAX 541.684.4909 Eugene, OR Portland, OR DATE: February 26, 2024 SUBJECT: Stormwater PROJECT: 2300348-Rosboro Mill TO: City of Springfield Public Works FROM: Matt Keenan KPFF Consulting Engineers PHONE: 541.735.9251 EMAIL: matt.keenan@kpff.com This memo has been prepared to address stormwater code requirements for the Rosboro Mill site in Springfield, Oregon. This project includes the revision of the campus operations through the removal of an existing on-site building and miscellaneous structures. It introduces two new buildings to improve mill operations and includes additional site access and parking. The City of Springfield Development Code states that all new developments shall infiltrate the full water quality storm, newly identified as 1.4 inches of rainfall for the 24-hour design storm. Given the site use, a relatively high groundwater table and the fact that the primary soils on site are deep layers of clay which aren’t suitable for infiltration, there would not be a feasible method of infiltration that would be adequate for this site. The next step in the treatment hierarchy would be a filtration facility. For the operations of the facility to maintain its efficiency, a significant amount of static storage is required and is already reserved on this site. Decreasing this storage area for a stormwater filtration facility would significantly impact the operability of the facility, making filtration a nonviable option for this site. After further investigation of this site and known constraints, the preferred primary treatment for the storm system would be a sedimentation manhole paired with a hydrodynamic separator, similar to a Contech CDS manhole. On the Rosboro Campus, the revised basin for this project does not currently house any log storage or any other activity that has been flagged for monitoring by DEQ under the 1200 -Z Permit. No pollution- generating activities are being proposed for this area. The log storage yards are typically the parts of the se industrial sites that require more focused treatment. Rosboro has robust protocols for vehicle-related spills or leaks and all catch basins proposed will be Gibson double chamber style, known for adequately retaining incidental spills. With those measures in place, no additional oil separation measures should be needed. The sedimentation manhole and hydrodynamic separator will sufficiently remove any solids from runoff and will fit into Rosboro’s current stormwater maintenance program for regular cleaning and inspection . Therefore, the revised basin will be treated entirely by the sedimentation manhole and hydrodynamic separator. Attachment: Basin Map 2300348- kg EEEE[F P ] [F P ]DERAILFOFOFOFOEOHUOHUOHUOHUOHUOHUOHU OHU OHUOHU OHUOHU OVERHEAD DUCTS OVERHEAD DUCTOVERHEAD DUCT48''SS48''SS48''SS48''SS[FP]16''W [W][W][W][W] [FP][FP][FP][FP][FP][FP] [FP][FP][ FP ][FP][FP]BBBBBBBBBBBBBBBBBBBBBBBRDRDRDRDRDMW #2TRANTRANEEEECECECECSSSCOCOWWVLTWWFPIVPIVPIVPIVPIVPIVPIVPIVPIVPIVPIVPIVPIVCITY FHRDMWCOTELVLTUBSDDDDDDGLULAM BUILDINGPLANER BUILDINGEXISTING LUMBERSTORAGE WAREHOUSEPLANER BUILDINGGLULAM BUILDINGBASIN 1TOTAL IMPERVIOUS AREA:159,657 SF = 3.67 ACRESBASIN 2TOTAL IMPERVIOUS AREA:373,421 SF = 8.57 ACRESSTORM TREATMENT STRUCTUREFOR BOTH BASIN 1 & 2EXH-1SHEET LEGEND B1FAC1GEC2DTSPSPSPSPTTTTGIJHThe following non-stormwater discharges may occur at the facility:·Discharges from emergency or unplanned fire-fighting activities;·Fire hydrant flushing and maintenance;·Potable water, including water line flushing;·Uncontaminated condensate from air conditioners, coolers, chillers, and from other compressors;·Landscape watering and irrigation drainage;·Exterior vehicle wash water that does not use hot water or detergent; restricted to less than 8/wk;·Pavement wash water that does not use hot water, detergent or other cleaning products, no spills or leaks of toxic orhazardous materials having occurred (unless spilled material has been removed), and surfaces are swept beforewashing;·Routine external building wash down that does not use hot water, detergents or other cleaning products;·Uncontaminated ground water or spring water;·Foundation or footing drains where flows are not contaminated with process materials.B2 SLIM17FAFC150/MVS Need help? Tech help line: (888) 722-1000 Email: sales@rablighting.com Website: www.rablighting.com Copyright © 2024 RAB Lighting All Rights Reserved Note: Specifications are subject to change at any time without notice Page 1 of 3 Color: Bronze Weight: 11.2 lbs Project:Type: Prepared By:Date: Driver Info Type Constant Current 120V 1.60A 208V 1.00A 240V 0.80A 277V 0.60A Input Watts 154.7/155.9/153.2W LED Info Watts 150W Color Temp 3000K/4000K/5000K Color Accuracy 80 CRI L70 Lifespan 100,000 Hours Lumens 18630/22217/19327 lm Efficacy 120.4/142.5/126.2 lm/W Technical Specifications Field Adjustability Field Adjustable: Color temperature selectable by 3000K, 4000K and 5000K Compliance UL Listed: Suitable for wet locations IESNA LM-79 & LM-80 Testing: RAB LED luminaires and LED components have been tested by an independent laboratory in accordance with IESNA LM-79 and LM-80. IP Rating: Ingress protection rating of IP65 for dust and water Performance Lifespan: 100,000-Hour LED lifespan based on IES LM-80 results and TM-21 calculations Wattage Equivalency: Equivalent to 750W Metal Halide LED Characteristics LEDs: Long-life, high-efficiency, surface-mount LEDs Electrical Driver: Constant Current, Class 1, 120-277V, 50/60 Hz, 120V: 1.60A, 208V: 1.00A, 240V: 0.80A, 277V: 0.60A Dimming Driver: Driver includes dimming control wiring for 0-10V dimming systems. Requires separate 0-10V DC dimming circuit. Dims down to 10%. Photocell: 120-277V selectable photocell that can be turned on and off. Surge Protection: L-N:6KV,L-PE:6KV,N-PE:6KV Construction Cold Weather Starting: The minimum starting temperature is -40°C (-40°F) Ambient Temperature : Max Power Temp Rating: 50°C (122°F) Middle Power Temp Rating: 50°C (122°F)) Low Power Temp Rating: 50°C (122°F) Housing: Precision die-cast aluminum housing and door frame Lens: Polycarbonate lens Mounting: Hinged wiring access and conduit entries on the back, sides, top and bottom make installation a snap Cut Off: Full cutoff (0°) Finish: Formulated for high durability and long-lasting color Green Technology: Mercury and UV free. RoHS-compliant components. Other Note: All values are typical (tolerance +/- 10%) 5 Yr Limited Warranty: The RAB 5-year, limited warranty covers light output, driver performance and paint finish. RAB's warranty is subject to all terms and conditions found at rablighting.com/warranty. SLIM17FAFC150/MVS Need help? Tech help line: (888) 722-1000 Email: sales@rablighting.com Website: www.rablighting.com Copyright © 2024 RAB Lighting All Rights Reserved Note: Specifications are subject to change at any time without notice Page 3 of 3 Dimensions Features Selectable CCT Full cutoff Selectable on/off photocell 0-10V dimming, standard Ordering Matrix Family Style Wattage Color Temp Finish Voltage Options SLIM17FA FC 150 /MVS FC = Full cutoff 40 = 40W 60 = 60W 100 = 100W 120 = 120W 150 = 150W Blank = 3000K/4000K/5000K CCT Adjustable Blank = Bronze Blank = 120-277V Blank = Selectable On/Off Photocell /MVS = Selectable On/Off Photocell w/ Microwave Occupancy Sensor SLIM17FAFC60 Need help? Tech help line: (888) 722-1000 Email: sales@rablighting.com Website: www.rablighting.com Copyright © 2024 RAB Lighting All Rights Reserved Note: Specifications are subject to change at any time without notice Page 1 of 2 Color: Bronze Weight: 7.1 lbs Project:Type: Prepared By:Date: Driver Info Type Constant Current 120V 0.50A 208V 0.40A 240V 0.30A 277V 0.25A Input Watts 57.9/58.4/57.2W LED Info Watts 60W Color Temp 3000K/4000K/5000K Color Accuracy 80 CRI L70 Lifespan 100,000 Hours Lumens 7035/8190/7251 lm Efficacy 121.6/140.3/126.7 lm/W Technical Specifications Field Adjustability Field Adjustable: Color temperature selectable by 3000K, 4000K and 5000K Compliance UL Listed: Suitable for wet locations IESNA LM-79 & LM-80 Testing: RAB LED luminaires and LED components have been tested by an independent laboratory in accordance with IESNA LM-79 and LM-80. IP Rating: Ingress protection rating of IP65 for dust and water DLC Listed: This product is listed by Design Lights Consortium (DLC) as an ultra-efficient premium product that qualifies for the highest tier of rebates from DLC Member Utilities. Designed to meet DLC 5.1 requirements. DLC Product Code: PLMK5TZVA46N Performance Lifespan: 100,000-Hour LED lifespan based on IES LM-80 results and TM-21 calculations Wattage Equivalency: Equvalent to 350W Metal Halide LED Characteristics LEDs: Long-life, high-efficiency, surface-mount LEDs Electrical Driver: Constant Current, Class 2, 120-277V, 50/60 Hz, 120V: 0.50A, 208V: 0.40A, 240V: 0.30A, 277V: 0.25A Dimming Driver: Driver includes dimming control wiring for 0-10V dimming systems. Requires separate 0-10V DC dimming circuit. Dims down to 10%. Photocell: 120-277V selectable photocell that can be turned on and off. Surge Protection: L-N:4KV,L/N-GND:4KV Construction Cold Weather Starting: The minimum starting temperature is -40°C (-40°F) Ambient Temperature : Max Power Temp Rating: 50°C (122°F) Middle Power Temp Rating: 50°C (122°F)) Low Power Temp Rating: 50°C (122°F) Housing: Precision die-cast aluminum housing and door frame Lens: Polycarbonate lens Mounting: Hinged wiring access and conduit entries on the back, sides, top and bottom make installation a snap Cut Off: Full cutoff (0°) Finish: Formulated for high durability and long-lasting color Green Technology: Mercury and UV free. RoHS-compliant components. Other Note: All values are typical (tolerance +/- 10%) SLIM17FAFC60 Need help? Tech help line: (888) 722-1000 Email: sales@rablighting.com Website: www.rablighting.com Copyright © 2024 RAB Lighting All Rights Reserved Note: Specifications are subject to change at any time without notice Page 2 of 2 Technical Specifications (continued) 5 Yr Limited Warranty: The RAB 5-year, limited warranty covers light output, driver performance and paint finish. RAB's warranty is subject to all terms and conditions found at rablighting.com/warranty. Buy American Act Compliance: RAB values USA manufacturing! Upon request, RAB may be able to manufacture this product to be compliant with the Buy American Act (BAA). Please contact customer service to request a quote for the product to be made BAA compliant. Dimensions Features Selectable CCT Full cutoff Selectable on/off photocell 0-10V dimming, standard Ordering Matrix Family Style Wattage Color Temp Finish Voltage Options SLIM17FA FC 60 FC = Full cutoff 40 = 40W 60 = 60W 100 = 100W 120 = 120W 150 = 150W Blank = 3000K/4000K/5000K Adjustable Blank = Bronze Blank = 120-277V Blank = Selectable On/Off Photocell /MVS = Selectable On/Off Photocell w/ Microwave Occupancy Sensor